DPCstruct | MC15989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0GF43 | 15-105 | NFDYAASDADDRRTWRARTQSMLVLPETDTEGDATGLYHVFSQSGSNYLADPELDSCTCPDMAHNDPENGCKHIRRVSLAIDETSLP… |
| A0A1G7UAG4 | 1-98 | MAVAPTSTPATTRRSVAAATEYIATCRVAPQLYEVVNDSGDTYVVDLREPACTCPDYEYRADSDDRVGEHGCKHIRRVRMERGEIDI… |
| L9Y7B5 | 14-108 | None |
| A0A371KYK9 | 61-132 | None |
| L0ICX1 | 1-88 | None |
| A0A256KKM3 | 11-120 | None |
| M0AFI0 | 6-124 | None |
| A0A6B0GPX2 | 6-93 | None |
| A0A847UPF6 | 12-96 | None |
| A0A1I2WXJ5 | 15-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.