DPCstruct | MC15987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 11.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3JMG1 | 1-87 | MEVYPFDHAQDVLGYSNQARYIYKYTKDINANTVVIEDHYIDKDYLIDYSKFYARSFDTPSTITKRLHFFSENFSTENFREMLVNCD |
| A0A0Q8RGH1 | 4-110 | YLVSQFAKSTLSNLVKESFGSDFPDIFSKKQVDYLFRYLKDLGAKSILLEFDYVDKDFLEDYSLYYVKRFSSAGNKCARLHFFSTEV… |
| A0A1Q2HT32 | 4-103 | None |
| A0A498H7J4 | 1-89 | None |
| A0A3S0V7K9 | 1-118 | None |
| A0A6N4UXF4 | 11-98 | None |
| A0A098LHB5 | 3-107 | None |
| A0A2N1P520 | 1-114 | None |
| A0A7C6D1I0 | 5-96 | None |
| A0A7C5H0L7 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.