DPCstruct | MC15986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 118 ± 27 aa |
| Standard deviation of domain lengths | 27.45 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9R4J7 | 24-107 | SYFGGFGFAMYGERDEHRDTKTYVKTHFLCLFFIPIFALGAYRVLQTGYEMWRVVGRVPLSSTAKKWNIVSLLAILSLSGLGGW |
| A0A0Q8QQ52 | 1-117 | MATSINGIGTTFYGQAGFEPDGSFITTKWVIFAYLPIIPTASMRVRYAGEENGFFSSGTSYQVIMDYPIDIGQVLRTWAYVISFITL… |
| A0A7J9Z9K2 | 18-111 | None |
| A0A4Q7L2L2 | 13-150 | None |
| A0A1G2IBV5 | 97-185 | None |
| A0A7H1KDE3 | 388-466 | None |
| A0A7W8IGC6 | 74-159 | None |
| B0CFB4 | 4-146 | None |
| A0A0H3D8Z8 | 1-132 | None |
| A0A368SZK9 | 10-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.