DPCstruct | MC15985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8Q7E5 | 36-140 | VSKKIDLPFTVESLSSVLSWAVTPNEGKISHQDVAHWCERFHMAMLDIETVHTMDVAIRVAADVDAQWGLYLANTYTLEELQNLDFL… |
| A0A520TJ71 | 1-97 | MPFTRESVLKMLTWGANPETSPYSHKQIAEWCDRFWCQYLEVDAEPEIEFLLPVLTDVETQWDLYLANTYSLEELRTNDFKNEQMPK… |
| A0A2V1K1B0 | 13-129 | None |
| A0A4Q7XHS9 | 8-111 | None |
| A0A7Y5WCP6 | 12-120 | None |
| A0A1C7EID5 | 2-109 | None |
| A0A644XQI6 | 2-109 | None |
| A0A0V8JII7 | 4-94 | None |
| M5U7N4 | 21-127 | None |
| A0A1X7DDD3 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.