DPCstruct | MC15983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B7Y233 | 62-169 | LTSSVVADKLVTVEGCDADLFVVCGLYYSDWHTGFGVYRVNAHDGCRDTDIPAMTSLCVDWDNSRGHFYFENQPRRCFTKTSTVRFT… |
| A0A2C5ZE69 | 1-146 | MRLSALAAVAAVDFLSGTPWMMTESYCRGNGGATRCYWNGKISTQFGIWGVDAASGCASRDIEKMEEFCIDNNRGRAYFRFGAQRNM… |
| A0A1B8AQQ3 | 1-127 | None |
| A0A2A9PGM5 | 1-151 | None |
| A0A2U3EAF3 | 2-147 | None |
| A0A5C3Q582 | 11-127 | None |
| A0A2C5ZJS5 | 1-105 | None |
| H1VT95 | 12-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.