DPCstruct | MC15981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 180 ± 27 aa |
| Standard deviation of domain lengths | 27.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 99.42 |
| Assigned Pfam label(s) | CL0047- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3KS02 | 389-585 | LVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPGHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS… |
| A0A2C5YUF3 | 317-498 | SHQHLFCLRVDPALDGHDNSLLVEESRPLEPSDPHGVGFAPRSRVVEREAGFDLDPASNRVFKLVNEGVRNPVSDTPVGFRLDPWPS… |
| S4RHK1 | 331-559 | None |
| A0A2I0IE58 | 243-413 | None |
| A0A2C9JXY0 | 534-713 | None |
| A0A7J0GDK5 | 225-355 | None |
| A0A378F3P1 | 5-156 | None |
| A0A2V1DC62 | 442-653 | None |
| A0A183TAP7 | 614-870 | None |
| A0A1Q4E107 | 201-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.