DPCstruct | MC1598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 147 ± 36 aa |
| Standard deviation of domain lengths | 36.48 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2R4Q3 | 1-102 | MFEPLPVVVKAVETAEGRARLYQDSHALDRARDSLRAGTLVRLAQALRVGPQATADDVVQAVARHLGRPVRDISGLIQERPSTATRL… |
| A0A7G9R2W6 | 23-154 | WPAWTGPGLVVATLALLAFAVARGRRLGRLVPEPLPVVVRAVETTESRAELYRAAADHARAAAVLRQASSRRLARRLGLAPGVDADA… |
| A0A5R1Z5T9 | 186-333 | None |
| A0A259SFP3 | 3-124 | None |
| A0A084Y034 | 73-286 | None |
| X8A136 | 232-358 | None |
| A0A516NYC0 | 204-342 | None |
| A0A7J9ZM60 | 336-485 | None |
| X8CP02 | 19-124 | None |
| A0A1U0Z7T3 | 101-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.