DPCstruct | MC15978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 437 ± 69 aa |
| Standard deviation of domain lengths | 68.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 87.78 |
| Assigned Pfam label(s) | PF12825- PF00787- PF12828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YLR2 | 1-436 | MNQDESRDESRDDSQDERQTKMALRPEQRRALFDILTHHQTYAEIQAFRRPETVTNYGFPISKSSPDDDDDNKKKLGSGSAPVLQML… |
| A0A010R0N5 | 9-507 | LTAEQTKALFNILTHFETYHEIEDFKKPETISDYGYPFAQSSKPGETVTYAPESSAPLLQSLFTRFILKLPGVSSFVPEFWNVRVQG… |
| A0A2P4ZHL2 | 1-416 | None |
| R1EYK6 | 1-407 | None |
| I4YAX9 | 307-804 | None |
| A0A5N5QTH1 | 491-963 | None |
| M3HKY7 | 301-686 | None |
| A0A0E9NNX4 | 59-556 | None |
| A0A0D2Y2G0 | 2-324 | None |
| A0A507F1V6 | 75-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.