DPCstruct | MC15977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 216 ± 47 aa |
| Standard deviation of domain lengths | 47.28 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 63.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 37.65 |
| Pfam Score | 86.81 |
| Assigned Pfam label(s) | CL0449- PF07713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RL74 | 2-277 | RESDDEDYVVYGTPLEPIEEDEVPRKKPIYIQDQIATDKQGRRRFHGAFTGGFSAGFYNTVGTPEGWLPAAFKSSREKKADLQAQRP… |
| A0A2C5XYK3 | 14-186 | DHAPFVVYGTPLPDDTESRDDGSFVPVWKQEVRDDKGRKRLHGAFTGGWSAGYFNTVGSKEGWTPSTFVSSRSNRRKDGPAPATQRA… |
| A0A7M7N5W6 | 1-133 | None |
| A0A0L9TRF6 | 4-219 | None |
| A0A507D3T3 | 37-285 | None |
| A0A3M6V3B7 | 4-187 | None |
| A0A0D0YB03 | 22-177 | None |
| A0A2J7PJK7 | 1-260 | None |
| A0A6V7X986 | 1-173 | None |
| A0A2G3CYT1 | 1-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.