DPCstruct | MC15975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A412K9W1 | 1-80 | MEQIAEFPHEMGLLLGYPVEDVEGFIENKGHNYLYAGYWKVYGHVEEKKALFNRYEEARKVLIQLLASGRSVSEMASCYA |
| A0A1C5VX99 | 125-194 | FPHEIGVFLGYPAEDVSGFIENEGQRYRMSGYWKVYGDISEAQTTFNAYDRAKDHAVNEFLIGKSIQEIA |
| A0A1Y4NHA1 | 125-200 | None |
| A0A3C0BIB7 | 107-179 | None |
| A0A2P8EKQ1 | 72-141 | None |
| A0A847PDB2 | 122-200 | None |
| A0A1C5MBU4 | 195-258 | None |
| A0A3D2N6C0 | 48-120 | None |
| A0A6N7VEZ0 | 11-80 | None |
| F7JJW8 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.