DPCstruct | MC15972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6RIW7 | 90-163 | EMIEIATNRRWEKTKHIANKDAKYGVYRYSTAFAFPVKQNNKITNIKSFDAELVILNSSDGKKYLYDIVNIKEN |
| A0A3R5W0W7 | 18-109 | KANTNAAQGLGEMLEIAFNGEVTPNKKLKHEIDGANGWYHYESRFGLSVYSENGEVERYNVFHVYMIVRHDKNGRKYLYDIINIKKE… |
| R5QP67 | 1-82 | None |
| A0A4S2A835 | 84-172 | None |
| A0A1Y3W7F6 | 13-113 | None |
| A0A1I3BTZ0 | 1-72 | None |
| A0A1G6DT00 | 3-94 | None |
| A0A3A8WVY7 | 26-117 | None |
| A0A2J8B5X8 | 425-502 | None |
| A0A564TXE8 | 138-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.