DPCstruct | MC15971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 118 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438EGJ1 | 18-137 | MEVMSPGTKGLQTYIMNRLLVYMYREFRAGEKRGSLPCIRADELSAQFPNISEPFLRKRLKHCADLQKGSNGLLFWVMRRNFRIPLE… |
| A0A3P6SSL0 | 1-115 | MYEVPSPNSKRATVFVRDFLLTFIYRLFWASDHIPRRLKMEDIKEAFPHYAESSVRKRLKQCSDFKRLGQGSEQNYWFDLRHLKGRL… |
| A0A452XC55 | 103-221 | None |
| Q54DH8 | 1094-1207 | None |
| A0A4Y2LWS0 | 533-657 | None |
| A0A813UCJ3 | 304-418 | None |
| A0A811RIA4 | 44-155 | None |
| A0A6J5W921 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.