DPCstruct | MC15969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6SFA5 | 1-120 | MIPEVSTITLARGSSSTSTDPWVFRKQLQRSDNYYRPDATSLPSMRQRLREVHNSSLVEEIQSSPGYTLTVGNITFKLAEAHGFCWG… |
| A0A2G2YNX1 | 5-153 | LQFSTISTHSDLSLPETRTFRFPKPFSAVVRCSAGEAAPSSSATAESEFDAKVFQKNLTRSANYNRKGFGHKEATLELMNREYTSDI… |
| A0A4D9C086 | 1-134 | None |
| A0A2J6JKJ7 | 1-149 | None |
| A0A2J8A4U4 | 1-151 | None |
| A0A448Z7X1 | 1-150 | None |
| A0A7J6NNP0 | 64-226 | None |
| A0A4D8YS96 | 1-123 | None |
| A0A7S1BWE2 | 41-206 | None |
| A0A7J8ZYS5 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.