DPCstruct | MC15968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 69.19 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | PF04227- CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TD00 | 80-132 | IIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVVCAGAKSILD |
| A0A835VHI6 | 446-500 | GIHVFVTGGIGGVHRHGETTMDISSDLTELGRTPVAVISAGVKSILDIPKTLEYL |
| A0A2G8LCZ5 | 85-140 | None |
| A0A653CFN6 | 37-98 | None |
| A0A3P6M6W8 | 53-107 | None |
| A0A5N5FXX7 | 470-524 | None |
| A0A7C1BAA1 | 39-100 | None |
| A0A671VAZ0 | 11-62 | None |
| A0A842PX38 | 3-64 | None |
| Q08ZG2 | 27-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.