DPCstruct | MC15966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 86 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 55.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4E1W0 | 615-719 | SVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP… |
| A0A444DJA6 | 138-210 | YKAKQYYEIILIDPAHGAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQ |
| A0A7J4ECD1 | 2-59 | None |
| M0ZZS8 | 1-65 | None |
| A0A498KSE3 | 106-183 | None |
| A0A4U0VUZ9 | 187-263 | None |
| A0A1V6SWC9 | 538-641 | None |
| A0A7J3WMQ0 | 4-76 | None |
| A0A1J8QFI5 | 100-201 | None |
| A0A7R8H4A4 | 207-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.