DPCstruct | MC15964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 64.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PVQ2 | 29-110 | SHRKFSAPRHGSKGFLPKKRSKRHRGKVKAFPKDDPSKPVHLTAFLGYKAGMTHVVREVDRPGSKVNKKEVVEAVTIIETPP |
| A0A444DEU6 | 1-94 | MSHRKFEHPRHGSLGFLPRKRASRHRGKGFDIFFCCHIFDAVKSFPKDDPSKLPGLTAFVGYKSGMTHIVREVDKPGSSKLLFVFLI… |
| A0A7G2E0L9 | 176-254 | None |
| A0A1I8ITS3 | 192-274 | None |
| A0A0D9XPH0 | 292-374 | None |
| A0A1B0BRX6 | 1-94 | None |
| A0A146I0Z6 | 830-912 | None |
| A0A284QYX5 | 518-600 | None |
| A0A212CLV5 | 35-104 | None |
| J4HZZ4 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.