DPCstruct | MC15961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1VE27 | 2-59 | EQLVGLPVADVERDLILATLRETGGNRTHAANMLGIAIRTLRNKISAYSANGHDVPDP |
| A0A7W6ICL1 | 16-76 | ALRQILVGRTIADVERHLILDTLAFCFGNRTHAAKILGISIRTLRNKLNEYMEAGIAVPEP |
| A0A3S0G5D3 | 6-63 | None |
| A0A257X0P0 | 218-283 | None |
| A0A7U2YPC5 | 3-60 | None |
| A0A257RGG2 | 34-108 | None |
| A0A1V1PHB0 | 94-155 | None |
| A0A7Y9FS34 | 86-143 | None |
| A0A4Q3GGA0 | 7-65 | None |
| A0A382IAM9 | 19-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.