DPCstruct | MC15956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 4 aa |
| Standard deviation of domain lengths | 4.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3G9S8 | 1-94 | MNILSMNGELRVERLNEWLDTMGDTVTPLQDESEVRIGVEEADARKLVMKLLRVYRNLSVNSGDCPPATALDMHHHIHTGDASPIML… |
| A0A6A3FF80 | 1-90 | MKLLELNGATSRELVSEWLKKLSLDDTPFEDEQNLNIGTDDEGGRALVIRLLRAYRVVTGGKGACPPATTLDVRHHIDTGNAAPVML… |
| A0A6A3S3N9 | 154-237 | None |
| A0A6G0QL75 | 187-281 | None |
| A0A6A3V323 | 54-155 | None |
| A0A6A3U598 | 1-94 | None |
| A0A225VZN1 | 765-857 | None |
| A0A6G0LJ96 | 68-161 | None |
| A0A6A4CSL1 | 154-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.