DPCstruct | MC15955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4YS26 | 1-66 | MVSTAIVPGALAFLWPAHIPALPDFRYVRVTSVQGSKAKVALVSLDGDDEALDEEVDIAVLQRRRV |
| A0A6A3EVT5 | 27-94 | MVSPKLAVGDLAFIDPAHAPALAEFGYVKVHRLDGSDAISRMAATDLDDGDDSQELSLPIDTLQLRIV |
| A0A6A3RTG5 | 2-68 | None |
| A0A6A4BPK9 | 1-71 | None |
| A0A6A4ED53 | 1-75 | None |
| A0A6A4ESI1 | 1-57 | None |
| D0NKB0 | 1-67 | None |
| G4ZWR5 | 1-69 | None |
| V9E801 | 3-72 | None |
| W2Z5D1 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.