DPCstruct | MC15953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 21.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4Z5I6 | 2-124 | PSHGPTPTVSTTTPRLPRPTKPCRRAAPSTLLASQLQLEGRRRAALWHDIRIKTLQTEFTTVHLKFPSSSFPTTRGPPSAPHYLLNQ… |
| A0A6A3E5N1 | 15-185 | LASPSTRPLVQIMLACPSTPGPLARLKSASPSTFEPLSRLKSTRPFTIENRSSPGLSSGGLPAQTTDTSTASRDVQSLQHRFEKTTV… |
| A0A329RMB5 | 1-152 | None |
| G5A9N6 | 8-189 | None |
| W2HJL5 | 246-400 | None |
| W2Q145 | 75-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.