DPCstruct | MC15950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 19.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3DV95 | 2-143 | LLWTGALDVDARPEKRLSDRALARILHDINSKRDARAHWVGDLTKGTWLALRNCDRIQKEEAKISKELRDDKYKFPEVPPFDPKEAK… |
| A0A225UZJ0 | 146-281 | DLVALQKSDATRYAHILGQALVPELLDRYGFQSVPEILIHAEAFDSTKDPKNRLSDVALARIRRDITSDERQHVPDLWVGGVSADPW… |
| A0A6A3ZHL6 | 235-348 | None |
| A0A6G0JJ73 | 11-185 | None |
| A0A6A3T9J3 | 4-178 | None |
| A0A6A3TV09 | 5-118 | None |
| A0A6A3UZG6 | 76-240 | None |
| W2G5Q4 | 101-236 | None |
| W2M3E9 | 79-236 | None |
| A0A6G0RWA2 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.