DPCstruct | MC1595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 71 ± 2 aa |
| Standard deviation of domain lengths | 2.01 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2YKQ4 | 145-214 | TGDKWPVYAQDVLNDAGEVIRKAGQRYDAHHLIESSFGGSNAWWNLHPAAFPSEHQAGIHATNSFANLMF |
| A0A135ZHN8 | 2-67 | ARYEEDKLSKRGRVYIRKGEYFDAHEIIPNQYNAPHSWWNIVPAERPNAHQGGIHGAGSGYSKIVD |
| A0A7X1CDA6 | 8-79 | None |
| A0A5B9MKA0 | 426-497 | None |
| A0A7Y9XQV6 | 298-368 | None |
| A0A161SGC7 | 4-74 | None |
| A0A3D8TQP3 | 430-502 | None |
| A0A1S9XQZ9 | 27-97 | None |
| A0A1S1CG64 | 52-119 | None |
| A0A0Q8X3D8 | 792-861 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.