DPCstruct | MC15949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 109 ± 23 aa |
| Standard deviation of domain lengths | 22.90 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3QC61 | 1-58 | MLPKQGNKTLCMRYISKKGCTGPAPGLCFDPNRAHFRPIALPADANAFIDKNFFGLGQ |
| A0A6A3DTY0 | 3-85 | RTTSRENRPEKHSGVPVAVLRSLPKQGSLELCIKYLSKTGCTGNGNPGKCFSSKRAHFRPKKLPANVKEYIEKTYGGLAPDFA |
| G4ZMW2 | 82-186 | None |
| A0A329RCU7 | 155-262 | None |
| G4ZKS8 | 345-459 | None |
| W3A6Y2 | 98-200 | None |
| W2HJL5 | 129-238 | None |
| A0A833T0C6 | 200-280 | None |
| A0A080ZHI7 | 262-348 | None |
| A0A225WW22 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.