DPCstruct | MC15946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452EVK9 | 8-177 | RSECVAALLMAGADLTAVDPVRGKTALEWAFLTDSFDTVQRIRQLLRRPQVEQLSRHYQPEWPALPGLVAQAQAAPSLLERLQATLT… |
| A0A4W5LX71 | 4-169 | MPLLICVFPLLGADVEARDYSRKMTSREWALFTCRYETAYLMMRLMAQPCAQQFCDSYKLEWPMLQELVAQRQESKSCWQKVADKVC… |
| A0A665V1N2 | 2-186 | None |
| A0A7M4E157 | 8-183 | None |
| A0A670YNI0 | 12-174 | None |
| A0A673AZX9 | 1-156 | None |
| A0A3B4GUI9 | 9-183 | None |
| A0A452VA69 | 1-183 | None |
| A0A3B5KBN0 | 10-181 | None |
| A0A671M033 | 28-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.