DPCstruct | MC15945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.50 |
| Pfam Score | 88.92 |
| Assigned Pfam label(s) | PF01186- CL0550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FEB0 | 1-86 | MADLVIDSLEIMRTAHLEDRQLFFLQCAMEENCLASAAYKLQTDHVASWHLETRRLLRFTARILNAGTADFRPMIPKHLWEFHQCH |
| A0A4W5LWH3 | 2-110 | SIQQCRRNTQVYCPRGGEGKAAGVTCVETAPDLVLDAQLVQETAYLEDRPLHLLTCANEENCLSSSAARMSWPYGHRRLLRFSSRIM… |
| A0A1B0BSJ1 | 469-581 | None |
| H3AUD5 | 463-554 | None |
| A0A1I8HYF9 | 417-524 | None |
| A0A7F8RFD4 | 328-437 | None |
| S4RIG2 | 81-192 | None |
| A0A665TLT7 | 164-309 | None |
| A0A7R9A9V8 | 529-624 | None |
| A0A7R9P1R6 | 178-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.