DPCstruct | MC15943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 95 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5LR98 | 2-91 | MEVDDPSVKGAMLTNTGRYAVPTIDAEAYALGKKERPPFVPRDQSSSEEDEDPVPDELLCLLCKDLMTDAVVIPCCGNSYCDDCELT… |
| A0A7R9HP52 | 99-192 | IKKSTGIPRSFMVPVDGPSAPGAMMTPTGQFAVPAIDHQAYKEGKKERPPFQQEPEPVMEKPEIPEDLLCTVCKDLLTDAVMIPCCG… |
| A0A5N4CVW0 | 191-283 | None |
| A0A7R9MMI3 | 82-181 | None |
| A0A1Y2G645 | 144-237 | None |
| A0A6H5II51 | 234-324 | None |
| A0A6P7ING1 | 191-283 | None |
| A0A6H5HRY2 | 61-159 | None |
| E7EXE9 | 183-281 | None |
| A0A3Q4AKX5 | 99-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.