DPCstruct | MC15940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 95 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9RNI5 | 1-68 | MFTTKTFKAGLLDAFKSAHAQSIAMPALMDALNKNNDSPFSPGEVKAALEFMEEANHIMVSENIVFLI |
| A0A4W5LPM6 | 1-88 | MDAPVPPSQDGQTDGQTEVSADRLKEFKSSLLEVFRSAHAQSVGMNSLMESVNKDRDAPFTLTEVRAALARMQDDNQIMVADDIIFLI |
| A0A446K4L2 | 582-666 | None |
| A0A7S0C0X4 | 323-409 | None |
| A0A2G9S9Q8 | 52-120 | None |
| A0A3P7EAU3 | 6-97 | None |
| A0A6P6FLX7 | 43-127 | None |
| A0A2D4N6R1 | 146-234 | None |
| A0A6A5ZW16 | 615-731 | None |
| A0A058Z5P7 | 855-943 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.