DPCstruct | MC1594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 17.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6NSQ7 | 35-180 | LPIEIAQSGIHPIYSCTAHYVEMLLKAEVPLVFSAFRMSGFTPSQICIQWLGQCFWNYLDWSEICHYVATCVIMGPDYQVYLCVSAL… |
| W5LF94 | 671-797 | CTAHYVEMLLKAEVPLVFSAFRMSGFTPSQMCIQWLSQCFWNYLDWPEICQYLATCIILGPDYQVYMCIAVLKHLQQDILQHTQTQD… |
| W2JB04 | 1015-1186 | None |
| A0A448XGU6 | 7-154 | None |
| A0A5K3ET06 | 316-456 | None |
| A0A5C6NPP6 | 789-925 | None |
| D8LGY7 | 359-522 | None |
| A0A7S1PGX0 | 58-205 | None |
| A0A1S3JQ29 | 826-956 | None |
| A0A7S4FVA8 | 520-703 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.