DPCstruct | MC15938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402EEJ0 | 1-130 | MLVAELRRVTVLWDELWLGVLLQQHMYVLRRIQQLEDEVKRVQNNNTLRKEEKIAIMREKHTALMKPIVFALEHVWSITAAPAETPH… |
| A0A4W5LM13 | 11-125 | LLWDELWLGVLQQQHMHVLRRIQQLEDEVKRVQNNNTLRKEEKVAIMCEKHSALMRPVVFALDHVRSITTTPAETPHETWFQQTYGD… |
| A0A0R3R5E3 | 144-270 | None |
| A0A6F9CN49 | 66-195 | None |
| A0A0M3IV55 | 166-278 | None |
| A0A0M3HJU2 | 1-114 | None |
| A0A820ESH9 | 6-127 | None |
| A0A0C2DDE9 | 54-180 | None |
| A0A2J7QAT6 | 28-156 | None |
| A0A820QI27 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.