DPCstruct | MC15937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9JV08 | 205-260 | HPDDVPCIAMVGSGGGLRALVAGTGSMLAAAEDGLFDCVTYTAGVSGSCWLQSLFN |
| A0A7R9JVS1 | 90-137 | SQVPRVAVLGSGGGFRAMVAFSSVLKTLHETGVFPCVTYLASLSGSSW |
| A7RMR9 | 243-296 | None |
| A0A3Q4AV70 | 34-91 | None |
| A0A402FP36 | 2-60 | None |
| A0A3B4BXL5 | 33-97 | None |
| A0A7R9FF44 | 71-118 | None |
| F6YW96 | 37-93 | None |
| A0A5C6MHM6 | 9-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.