DPCstruct | MC15936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 335 ± 49 aa |
| Standard deviation of domain lengths | 49.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12726 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1I8K1 | 45-386 | VDPAVEAERIRKIEEAQKRKHLVLDAFRILAYNGAEAAPYRDWLQLRLEHWMTTCHICIRVFHASRSLLRQRLEEQYDVEQVVEFMK… |
| A0A4W5LF93 | 2-317 | STCRWCTSFGDDVAKLLQRYCAGSWLAEDEEKALNDDLDKCLECVVVYHRAKEELPGLHRRLWELETSRLLDLFSHAAKDAEPAKDL… |
| A0A453L6E6 | 1-297 | None |
| Q92355 | 21-381 | None |
| L5K9Y0 | 18-282 | None |
| A0A5D3BWW8 | 157-473 | None |
| A0A6N2LBK7 | 3-380 | None |
| C5FD29 | 25-411 | None |
| A0A2P2M1G6 | 4-286 | None |
| A0A421FDM5 | 59-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.