DPCstruct | MC15935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3R342 | 6-112 | LNTTDVTVIDQLRAILRNAIYPVRINNLIQITGVNMSTVCYPNGTGFQCRCEDQYRWSCDQCVSYGNCDDITSDTCGCINAIPPDGQ… |
| A0A4W5LEY1 | 1-101 | MTDISATLIDVLRASVNGLIYPVLISNVLNVTDVNFTTACYPNSTCRCEDQYGWSCDQCLAFESCDNITDDSCGCIKAIPPYGLFCQ… |
| A0A498M757 | 9-106 | None |
| A0A6P8SMZ8 | 201-319 | None |
| H3C4K8 | 129-242 | None |
| A0A4Z2J451 | 123-226 | None |
| A0A498NYA5 | 432-527 | None |
| A0A6P8SLN1 | 164-279 | None |
| A0A2D0QIP6 | 16-112 | None |
| A0A6P8V0K6 | 60-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.