DPCstruct | MC15933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 56 ± 1 aa |
| Standard deviation of domain lengths | 0.73 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 72.52 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0023- PF01031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A665WD74 | 29-85 | LKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDID |
| A0A183EGV1 | 65-120 | IFCSFVDPQGLRTIGVLTKLDLMDEGTDARDILENRLFPLRRGYVGVVNRGQKDIV |
| A0A672JV79 | 1-56 | None |
| A0A183KDF2 | 7-63 | None |
| C6HFE6 | 222-276 | None |
| A0A6I9NQC9 | 145-201 | None |
| A0A2G9UDF0 | 29-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.