DPCstruct | MC15932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 27 aa |
| Standard deviation of domain lengths | 26.99 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FF90 | 168-251 | VEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQLVAVNYIPE |
| A0A4W5LCD2 | 6-122 | SLGCVVDHVVLTPWCGLCFTVTTLRQRLLQPDFQPAGASQLHPKHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQLVAVSYIPE… |
| A0A817QF72 | 210-297 | None |
| A0A4P9Y5A2 | 1-78 | None |
| A0A5B7DET2 | 49-206 | None |
| A0A5N5TGF2 | 158-307 | None |
| A0A653DTB7 | 198-281 | None |
| A0A183VY07 | 109-246 | None |
| A0A2H1BX59 | 1-169 | None |
| A0A1Y2CUY9 | 54-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.