DPCstruct | MC15931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 88 ± 4 aa |
| Standard deviation of domain lengths | 3.72 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 66.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF03234- PF08565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8X4D4 | 116-202 | RREEKKIPWNVDTISKEGFSRSVFNIEAETEEEEEDAEKRRTFLETHGKEIKHFGMLRRWDDSQKYLSDNPQLVCEETAHGLVSTCI |
| A0A2I2UF65 | 136-223 | RKKEKSMPWNVDTLSKDGFSKSMVNTKPKQTEESSEEVREQKHKTFVEKYEKQIKHFGMLHHWDDSQKYLSDNVHLVCEETTNYLVIW |
| A0A643BL14 | 1-92 | None |
| A0A6P5C293 | 69-158 | None |
| A0A3P9MSG2 | 33-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.