DPCstruct | MC1593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 157 ± 30 aa |
| Standard deviation of domain lengths | 30.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | PF09745- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2FZW4 | 1-117 | MVFNIHVGATVNSLQKCSLVPGGTEVLLYTTLSGSIGVLAPFSVKEDIDFMQHIELYIRQALPSIVGRDHIAYRSYYFPLKSVIDGD… |
| A0A6P6NS69 | 11-169 | AATTDEERQHLQEVGLFHLGEFVNVFSHGSLVLQNLGESSTPTQGSVLFGTVNGMIGLVTSLSESWYSLLLDLQIRLNKVIKSVGKI… |
| A0A7S0XN41 | 74-199 | None |
| A0A7S0XMJ1 | 327-439 | None |
| A0A7J8C1A5 | 454-616 | None |
| A0A183Q589 | 4-112 | None |
| A0A086JLS9 | 2-180 | None |
| A0A4Z2HZ40 | 861-999 | None |
| A0A2J8ABD5 | 578-762 | None |
| A0A7J0FYQ1 | 111-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.