DPCstruct | MC15927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4ZP01 | 135-272 | PVIHAQNAKITTCMDNILAQSASVIDSAHTAISTWVTAAPNDNVFQTIIGLSYPNKGAPNAAALIFAAPLGANRCQGQTVQIYPTAQ… |
| A0A142JR74 | 12-140 | KSCAGLIAQLGDSLTQGARFTANTQAQKNAPNDHAVQAVAGLAYDAPGYQGKAAGIVFTAPTRSGCEGNLVRVAPFTQSCQDVVRLL… |
| A0A8A7B2X0 | 127-254 | None |
| A0A4Q7IKH4 | 11-136 | None |
| A0A2G6EU40 | 13-147 | None |
| M4UKQ0 | 9-115 | None |
| A0A2G6LAH4 | 23-174 | None |
| A0A368K0W0 | 2-118 | None |
| A0A7D7ZE05 | 2-174 | None |
| A0A2S9Q5F5 | 74-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.