DPCstruct | MC15922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496D0Z1 | 3-75 | TNENFNLWCIVELFGHNRIAGKCSEQSIAGNNFLRVDVPTTSKQSGFTRFLSASAIYAINPVTEEVARQITEI |
| A0A142JGR6 | 4-97 | QPQKQYAIIELFGHARIAGQISEQTFGGTTFVRIDVPEITYCVSGQKGDERAVIPAHTVTFGPGSIYAINWCDEAASVLAAHSIRRE… |
| A0A7S7TM99 | 4-131 | None |
| A0A480AIE8 | 29-126 | None |
| A0A2W6VVE4 | 11-107 | None |
| A0A1G8KAQ7 | 2-95 | None |
| A0A7Y5T3I1 | 31-130 | None |
| A0A1V5CZR8 | 4-85 | None |
| A0A7Y9PD17 | 52-146 | None |
| A0A3A0A105 | 114-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.