DPCstruct | MC1592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 168 ± 10 aa |
| Standard deviation of domain lengths | 9.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9CFA1 | 7-179 | EDHLYFWFPLLAGLSELSFDPRPEIRKSALQILFDTLRNHGHLFSLPLWQRVFESVLFRIFDYVHHAIDPVGEGGDGEIAEFDQDSW… |
| A0A6P6NRY6 | 1-170 | MNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTC… |
| A0A287TTS7 | 1-148 | None |
| A0A6J0PET4 | 826-999 | None |
| A0A4S4ERM9 | 93-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.