DPCstruct | MC15919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 150 ± 29 aa |
| Standard deviation of domain lengths | 28.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11748 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537C9G3 | 9-135 | LRRWSRLKRESAAQKPAAPENPPQLPPLDSLTFESDFKAFMHSKVEEGVKRAALKKLFSDPRFNVMDGLDTYIDDYTKAEPVTEELL… |
| A0A0Q7XG03 | 1-131 | MAAETFFARWSRVKVEARQEPVAQEPAATEAPAEATAPAPTLEQVESLTTDSDFTPFVARGVDEAVRRAALKKLFADPRFNVMDGLD… |
| A0A4U1BMU5 | 61-187 | None |
| A0A2J0YYK8 | 1-211 | None |
| A0A1H7GYH8 | 48-173 | None |
| A0A1B1UDS6 | 22-162 | None |
| A0A2N7UET8 | 53-160 | None |
| A0A536T5N1 | 26-173 | None |
| A0A836WV99 | 44-189 | None |
| A0A2D6PN69 | 6-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.