DPCstruct | MC15918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 599 ± 57 aa |
| Standard deviation of domain lengths | 56.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4EDF9 | 4-624 | AKARSSSSEVPPKISSRAIRQLKPAALETDSTSALTQISRIPKDRSPKVVERRSPRSPVSEKKRPSRISELESQVSQLREELKKTED… |
| A0A0K9QKH3 | 36-624 | RQLKTAGSGSGSIASPNSLSKKRSPKALERGSPRTPTTEKHTPSKLSEVQSQLAELEDEFKRAKDQLISSEAVKWRAQQECEETKKQ… |
| A0A6J0MWK0 | 25-553 | None |
| A0A1U7Z8E6 | 1-729 | None |
| A0A2I0W0M9 | 29-604 | None |
| A0A6P8DA99 | 3-587 | None |
| A0A1R3HQK4 | 1-613 | None |
| A0A6A2YSV8 | 1-582 | None |
| A0A817B9I5 | 234-870 | None |
| A0A6I9R8Y7 | 4-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.