DPCstruct | MC15917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0TEW9 | 6-134 | AGAAGAGDSDLVVHQDDLGAVGHEAFILHGELKKKADVAGAGVDKNGSGSTMQAAAALKSHNLGLGAELESTVEIWTSQVKHVLQAC… |
| A0A4Y3R422 | 38-135 | GKHGEKSDLVVHDDELGALGHMAFELRARLSTIGNHASQTTASAAGEMSSDGLDAGSALRELHDAWGTKLATVKEACAHISNHLDYS… |
| A0A1H4ZDK8 | 6-104 | None |
| A0A250VIH0 | 114-231 | None |
| A0A0F7FXE3 | 3-120 | None |
| A0A1Q5A4F6 | 7-115 | None |
| A0A4Z0G8Q9 | 21-137 | None |
| S4AWW9 | 1-118 | None |
| A0A399HGS8 | 4-101 | None |
| A0A2J7YWW0 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.