DPCstruct | MC15914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 161 ± 36 aa |
| Standard deviation of domain lengths | 35.51 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 99.33 |
| Assigned Pfam label(s) | CL0036- PF00710 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485JCY7 | 1-131 | MNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYFLDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKASANRGVL… |
| A0A813I6C4 | 63-217 | RKVLILYTGGTIGMSDIGGTLGLVPGSLLKQLQSLQGLNQMKMPQCLFDEFSPILDPADMCPEDWCKIAGVIEKAYYEYDGFVVLHG… |
| A0A485BDM2 | 21-165 | None |
| A0A7J6PEK9 | 35-202 | None |
| A0A6N2ECW0 | 6-172 | None |
| A0A498LS76 | 18-218 | None |
| A0A0R3Q3P6 | 40-192 | None |
| A0A1W0X426 | 20-223 | None |
| R7U3G3 | 138-284 | None |
| G4TP66 | 185-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.