DPCstruct | MC15912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 310 |
|---|---|
| Mean domain length (aa) | 147 ± 36 aa |
| Standard deviation of domain lengths | 36.10 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 97.15 |
| Assigned Pfam label(s) | PF02515- CL0063- CL0020- CL0442- PF16101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098E8M6 | 1-184 | MYAFIGIGQGGCGLLDSAFYDKDLFKVAKPIAINSTAKDLKNLKHIKQEYWLGMSKDKGFIDGTTKNLESYLVGGYGQDRTKSKDDA… |
| A0A813HXB2 | 1-150 | MREALCIHLGQGGVQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPRCVMVDLEPTVVDEVRTGTYRQLF… |
| A0A842X6Z5 | 21-196 | None |
| A0A1R3KMF2 | 3-153 | None |
| A0A2V1D074 | 150-300 | None |
| A0A7R9A3B1 | 2-110 | None |
| A0A7R8X2X5 | 1-163 | None |
| A0A6J5VNR4 | 16-127 | None |
| A0A821CCJ5 | 2-145 | None |
| A0A2D0PJZ2 | 2-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.