DPCstruct | MC15911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4RJL4 | 65-190 | LDHRGTVYHEDLAAAEPLLACGARVLADNVLLPGAPLFLCWVEERHDVAIHDVPEFMRPDLDDWIVVSAPRRSASAAAGSSAARRDV… |
| A0A813HV16 | 1-154 | MDQGGSRFWQDLETLRKQDLLLPGCVIIADNVLKPGAPLFLWQLCKGAGSREFTTEIISLEEFAMAGVEDWMSVATYHPEAAGARST… |
| A0A1Q9E758 | 320-475 | None |
| A0A7S4QFG0 | 203-340 | None |
| A0A813K8D1 | 229-370 | None |
| A0A812JMV7 | 357-517 | None |
| A0A812G9E6 | 673-812 | None |
| A0A812SB23 | 339-484 | None |
| A0A7S4QPB9 | 1-156 | None |
| A0A812W8H2 | 47-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.