DPCstruct | MC15910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 164 ± 34 aa |
| Standard deviation of domain lengths | 33.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0R0A8 | 6-142 | LLESIFNTDITSTDIKSVRIPPPPPMRHDELLSVIKELNIDHSILDNYTPDITWKGQPLNIAHLPHYNELHEIEAKVVSILRLTPVQ… |
| A0A7C8V7Q1 | 11-176 | KRSHQRSRSSGSDIAAFPNDKVRIHRNTDNKVIKPKFSRQSKPVTTTRKDVHFLTVEDVTPLVDLLPDNPRCLHVDWSGAPLDISND… |
| A0A1X2IM19 | 8-195 | None |
| A0A1S8VR50 | 402-554 | None |
| A0A438DQ37 | 37-167 | None |
| A0A2T4CE77 | 35-226 | None |
| A0A0B7N0N5 | 1-159 | None |
| A0A094K677 | 40-223 | None |
| A0A6P3ZG45 | 191-318 | None |
| M2MYC3 | 166-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.