DPCstruct | MC1591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6NPG5 | 38-114 | FCLLKGFFLTVSLESILKVAKHASENNKIFCINLSAPFICEFFKEALMKVMPYVDILFGNETEAAVFAQEQGFEVSG |
| A0A7I0ZEH0 | 70-150 | KAKFFYASGFFVAVSPESIMLLCEHAHTKGHTFVMNLSAPFVSQFYKDPLEKLLPYVDVMFGNESEAEAFAKAFGIKATDL |
| A0A821RV61 | 57-117 | None |
| A0A0C2XAS6 | 1008-1102 | None |
| A0A2U3EJA8 | 707-806 | None |
| A0A820M1X8 | 1-73 | None |
| A0A0K0DSJ8 | 199-270 | None |
| A0A3F2S2X4 | 577-649 | None |
| A0A401G563 | 274-360 | None |
| A0A813Z598 | 166-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.