DPCstruct | MC15909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 196 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3IL85 | 2-157 | VDIAKLDWDSYETSWGFLVNPLVHKSQSFDTIEAAWLTQSEHWRSVSLDLKTLEQENNQLCINAYGLQCELEPAVMLEDITLTSNAH… |
| A0A6F8XCV0 | 1-187 | MSGDIEKLPYIRNQLNVDDYTKRLILVARHDWDSYEVSWDFIKQPLLHVDFCQPMLKTSYQNLRAHWRELTLEMHRLEEENNRIFIE… |
| A0A1M7HIK7 | 135-330 | None |
| Q8KQY7 | 1-204 | None |
| A0A644ZJC9 | 35-230 | None |
| A0A7H9ZF82 | 569-783 | None |
| A0A7K1J3S9 | 1-182 | None |
| A0A5C7F6G2 | 840-1076 | None |
| A0A5C0S9C7 | 710-896 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.