DPCstruct | MC15908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 430 ± 50 aa |
| Standard deviation of domain lengths | 49.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014CLI5 | 1-394 | MKRDQPVFTMDWIEKGQQVDEVLDKLWDYWILAKDSKTFSDDEIIGNIVISAMLYSGLNQKASLEALLEHLKDPAKIRKIEDLNIIF… |
| A0A6F8XBQ5 | 1-504 | MSDSDHAIWSGWKLSPPKKSTSDGQEERRYQRACERYQRWKAILASLEQQVTGIMSGQRDIVMPDAVIAAAFDALHQQAPPSTLKIT… |
| H3ZFF6 | 22-442 | None |
| A0A378PNH0 | 1-389 | None |
| A0A522LTT3 | 53-433 | None |
| A0A7U6R485 | 22-520 | None |
| A0A7Y4AMI0 | 23-437 | None |
| T1CH91 | 1-505 | None |
| N8WN94 | 1-386 | None |
| A0A2N1DAP0 | 1-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.