DPCstruct | MC15905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1SPY3 | 3-150 | SVLAATLLLLLVNGSQATGGGGGRGHHQQHERGTPATKEREKWEACAKDRQCLDADCSSCTDDDLPCQRTCVWKCLCGCGGRPWGDK… |
| A0A6J1SPV2 | 71-207 | LDDAQLPGGRDLHRRRRSASEEKRKWQECEKERQCHQATCSQCGGDDGNCKVMCWNNCECACGGYARGGMDHRLWRECYTQCPGKYW… |
| A0A6J1SUD9 | 193-317 | None |
| A0A6J1SCB7 | 86-233 | None |
| A0A6J1SR82 | 4-175 | None |
| A0A6J1SR05 | 31-143 | None |
| A0A6J1TFS3 | 1-197 | None |
| A0A6J1TCV6 | 10-192 | None |
| A0A6J1SX17 | 78-202 | None |
| A0A6J1T1T9 | 31-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.